DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ECI1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_013386.1 Gene:ECI1 / 850990 SGDID:S000004274 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:47/218 - (21%)
Similarity:87/218 - (39%) Gaps:24/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAG 100
            |.:..|::|.   ..:|.|..|...|:..........::||...::......:::| |...|.:|
Yeast     9 EKISYRIEGP---FFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQS-SGRFFSSG 69

  Fly   101 ADLK-------ERKGMTPEEATEFVKEL--RGLLI--AIEQLPMPVIAAVDGAALGGGLEMALAC 154
            ||.|       :.....|.|.:::|...  |.:.:  |..:....:|..::|.|:|....:...|
Yeast    70 ADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALC 134

  Fly   155 DIRTAASDTKMGLVE--TRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHV 217
            ||..:.:| |:.|:.  ..|.:|...|.|..||.........|.:    :||.....|:...|..
Yeast   135 DIVYSIND-KVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECL----MFNKPFKYDIMCENGF 194

  Fly   218 VKQNETQDAAYQQAL--KLAEEI 238
            :.:|....::..:|.  |:.||:
Yeast   195 ISKNFNMPSSNAEAFNAKVLEEL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 44/206 (21%)
ECI1NP_013386.1 CaiD 6..243 CDD:223955 47/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.