DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and AT4G16800

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_193413.2 Gene:AT4G16800 / 827386 AraportID:AT4G16800 Length:301 Species:Arabidopsis thaliana


Alignment Length:262 Identity:133/262 - (50%)
Similarity:189/262 - (72%) Gaps:4/262 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGA 101
            |.:.||.|:..||..:.|:||..||:.::.|:::..:..|.|.:||.:|||::|||.||:|||||
plant    43 VKLNRLSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGA 107

  Fly   102 DLKERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMG 166
            |||||:.|:|.|...:|..||.:...||.|.:|.|||::|||||||||||||||:|....:...|
plant   108 DLKERRTMSPSEVHTYVNSLRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAVFG 172

  Fly   167 LVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQA 231
            |.||.|||||||||||||.|::..:::||||||.|..:..||.:.||||..|...|    |:::|
plant   173 LPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGE----AHEKA 233

  Fly   232 LKLAEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVY 296
            :::|::|...||:.::|||.|||:|::.::|:|..:||:||.:::.|:|||||||||||||||:|
plant   234 IEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRKPLY 298

  Fly   297 KG 298
            .|
plant   299 TG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 129/251 (51%)
AT4G16800NP_193413.2 PLN02600 51..300 CDD:178210 128/252 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 261 1.000 Domainoid score I480
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1284
Inparanoid 1 1.050 268 1.000 Inparanoid score I934
OMA 1 1.010 - - QHG53571
OrthoDB 1 1.010 - - D1123666at2759
OrthoFinder 1 1.000 - - FOG0002752
OrthoInspector 1 1.000 - - oto3354
orthoMCL 1 0.900 - - OOG6_102410
Panther 1 1.100 - - LDO PTHR11941
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.