DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ECHIA

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_193356.2 Gene:ECHIA / 827314 AraportID:AT4G16210 Length:265 Species:Arabidopsis thaliana


Alignment Length:261 Identity:84/261 - (32%)
Similarity:129/261 - (49%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKER----KG 108
            ||:||.:|||.:.||.:|.|:.......:|:..|...:||:... |...||:|.||...    ||
plant    18 GIAVITINRPKSLNSLTRAMMVDLAKAFKDMDSDESVQVVIFTG-SGRSFCSGVDLTAAESVFKG 81

  Fly   109 MTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLA 173
            ...:..|:.|       :.:|:|..|:|.|::|.|:..|.|:||||||..|:...|......|..
plant    82 DVKDPETDPV-------VQMERLRKPIIGAINGFAITAGFELALACDILVASRGAKFMDTHARFG 139

  Fly   174 IIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEI 238
            |.|..|.:|:|.||:....|:|:..|:.......|..||.|||||::.|    |.::|.::||.|
plant   140 IFPSWGLSQKLSRIIGANKAREVSLTSMPLTADVAGKLGFVNHVVEEGE----ALKKAREIAEAI 200

  Fly   239 LPNGPVGVRMAKLAIDKGMQVDLATGYSIEE----ICYSQVIPTKDRLEGLAAFAEKR---KPVY 296
            :.|....|...|..|:.|:::||....::|:    ..||.:  ||::...:..|...|   ||..
plant   201 IKNEQGMVLRIKSVINDGLKLDLGHALTLEKERAHAYYSGM--TKEQFRKMQEFIAGRGSKKPSS 263

  Fly   297 K 297
            |
plant   264 K 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 84/261 (32%)
ECHIANP_193356.2 PLN02888 1..262 CDD:215480 82/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.