DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and hibch

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001014338.1 Gene:hibch / 798364 ZFINID:ZDB-GENE-050327-29 Length:382 Species:Danio rerio


Alignment Length:367 Identity:81/367 - (22%)
Similarity:141/367 - (38%) Gaps:81/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSMLIKRASGLARQLAR-PLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFS 64
            ||::|..::...|.:.| ..:....::|.|    |:|||.|::..|    .||.||||.|.|:.:
Zfish     1 MSLIIFTSAQRLRSVCRLQRIHGHMMSSKA----GSEVLFEKVGKA----GVITLNRPKALNALT 57

  Fly    65 RGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKE-----RKGMTPEEATEFVKELRGL 124
            ..|:......|:...||:.:.:|:::......||||.|::.     :.|....:.  |.:|...|
Zfish    58 LNMIRHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIAEAGKAGNLLSQV--FFREEYIL 120

  Fly   125 LIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILS 189
            ...|.....|.:|.::|..:|||:.:::....|.|...|...:.||.:.:.|..||...||| |.
Zfish   121 NNTIGTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPDVGGGYFLPR-LQ 184

  Fly   190 PALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQ---------------DAA-----YQQ---- 230
            ..|...|..|.....|.:.:.:|:..|.|:..:.:               |.|     ||:    
Zfish   185 GKLGLFLALTGFRLKGRDVQRVGVATHFVQSEKIESLEKDLVDLKSPSISDVAQLLDSYQEQSHL 249

  Fly   231 --------------------------------------ALKLAEEILPNGPVGVRMAKLAIDKGM 257
                                                  |||.||.:....|..:::....|::|.
Zfish   250 DAEKPFVLQEQTEAIDRLFSAGSVEEIVENLKKDGSAFALKQAETLAKMSPTSLKLTFRQIEEGA 314

  Fly   258 QVDLATGYSIEEICYSQVIPTKDRLEGLAA--FAEKRKPVYK 297
            ::.|...:.:|.......:...|..||:.|  ..:.:.|.:|
Zfish   315 RMSLQEVFMMEYRLSQACMNGHDFYEGVRAVLIDKDQSPKWK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 68/319 (21%)
hibchNP_001014338.1 PRK05617 30..374 CDD:235533 75/338 (22%)
ECH_2 43..371 CDD:292731 68/317 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.