DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Eci3

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_081223.1 Gene:Eci3 / 69123 MGIID:1916373 Length:317 Species:Mus musculus


Alignment Length:295 Identity:73/295 - (24%)
Similarity:125/295 - (42%) Gaps:27/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LARQLAR----PLVASRNLASAAP----------YGDGTEVLVERLDGARQGISVIGLNRPAAKN 61
            |.::.||    .||:|.:.:|.||          ..:..::||...|    ||:.|..|||..||
Mouse    24 LPKETARKNYVDLVSSLSSSSEAPSQGKRGADEKARESKDILVTSED----GITKITFNRPTKKN 84

  Fly    62 SFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLK---ERKGMTPEEATEFVKELRG 123
            :.|..|.......|::...||.  |:.:.:.:...:.:|.|||   ...|...:......|.||.
Mouse    85 AISFQMYLDIMHALKNASTDNS--VITVFTGTGDYYSSGNDLKNLINDAGEIQDVVATSTKILRE 147

  Fly   124 LLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRIL 188
            .:......|.|::|.|:|.|:|..:.:....|...|:.........::|:.||.|..|...|:|:
Mouse   148 FVNCFIDFPKPLVAVVNGPAVGIAVTILALFDAVFASDRATFHTPFSQLSQIPEACSTYMFPKIM 212

  Fly   189 SPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAI 253
            .|..|.|::...:.....||...|||..|..::..:...:.: ||...::.||   .:|::|..|
Mouse   213 GPTKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTR-LKTYSKLSPN---VMRISKELI 273

  Fly   254 DKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAF 288
            .|..:..|.|..:.|.....:.:|.::..:.|..|
Mouse   274 RKHEKQKLYTVNAEECAAALERMPREEYAKALRNF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 61/244 (25%)
Eci3NP_081223.1 ACBP <2..37 CDD:376410 3/12 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..60 3/19 (16%)
crotonase-like 64..256 CDD:119339 50/198 (25%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 120..124 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 315..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.