DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Echdc3

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_077170.2 Gene:Echdc3 / 67856 MGIID:1915106 Length:300 Species:Mus musculus


Alignment Length:303 Identity:79/303 - (26%)
Similarity:146/303 - (48%) Gaps:27/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKRASGLARQLARPLVAS-RNLASAAPYGDGTEVLVERLDGARQ--GISVIGLNRPAAKNSFSRG 66
            :|..|.|.|....||.|. .:..||.|.|..:|   .||...||  ||..|.|:.|..:|:.|..
Mouse    12 VKWPSWLRRNPWAPLSAGFCSPGSAGPAGSESE---PRLTSTRQQDGIRNIVLSNPRRRNALSLA 73

  Fly    67 MVETF-NDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKEL----RGLLI 126
            |:::. :|:|.:.:.:: .:|:::.:..| :|.:|.||||   :|..:..::..|:    ..:::
Mouse    74 MLKSLRSDILHEAESED-LKVIIISAEGP-VFSSGHDLKE---LTDAQGRDYHAEVFQTCSEVMM 133

  Fly   127 AIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAII---PGAGGTQRLPRIL 188
            .|...|:|::|.|:|.|...|.::..:|||..|:..:........:.:.   |.....:.:||  
Mouse   134 LIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPAVALGRAVPR-- 196

  Fly   189 SPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAI 253
              .:|.|::||....:..||...||::.||.:.:.:    .:.:::|::|.......|.:.|...
Mouse   197 --KVALEMLFTGEPISAQEALRHGLISKVVPEEQLE----AETMRIAKKISSLSRSVVALGKATF 255

  Fly   254 DKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVY 296
            .|.:..||.|.|.:........:..:|..||:.||.:||||::
Mouse   256 YKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKRKPIW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 63/257 (25%)
Echdc3NP_077170.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..53 8/21 (38%)
crotonase-like 35..299 CDD:304874 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.