DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and echdc1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001315065.1 Gene:echdc1 / 553585 ZFINID:ZDB-GENE-050522-370 Length:302 Species:Danio rerio


Alignment Length:317 Identity:87/317 - (27%)
Similarity:147/317 - (46%) Gaps:36/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSM-------LIKRASGLARQLARPLVASRNLASAAPYG--------DGTEVLVERLDGARQGIS 50
            |||       ||:..|.:.:.|.:    :|...|.:..|        .|..|.:::|.  ..||:
Zfish     2 MSMWGAVRCRLIQTRSAVRKILQQ----NRAFCSGSSVGIREKLLAFPGGSVELQKLQ--ESGIA 60

  Fly    51 VIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGM-TPEEA 114
            |:.::.||..|:||..|:......:.:::.....:.|:::. :.|.||:|:||...:.: .|.:.
Zfish    61 VLTVSNPARMNAFSGCMMLELEQRVNELEIWTEGKAVIVQG-AAGNFCSGSDLNAVRAIANPHDG 124

  Fly   115 TEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAG 179
            .:..:.::..|..:.:||:..:|.|:|.|||||.|:..|||.|...||..:..|...:.::||.|
Zfish   125 MKMCEFMQNTLARLLRLPLISVALVEGRALGGGAELTTACDFRLMTSDAVIQFVHKHMGLVPGWG 189

  Fly   180 GTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEE-ILP--N 241
            |..||..|:....|.:|:..||..:....|.:|||:.|::.:..:.    :||..||. |.|  .
Zfish   190 GAARLVGIIGSRNALKLLSGARKVDPDYGKQMGLVDEVLQCSSGEG----KALAHAEHWIAPFIK 250

  Fly   242 GPVGVRMA-KLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYK 297
            ||..|..| |..:..|.::.|......|...:..|......||.||:     ||.:|
Zfish   251 GPAPVIQAIKKVVVSGRELSLDEALKCERSVFGTVWGGPANLEALAS-----KPKHK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 74/255 (29%)
echdc1NP_001315065.1 crotonase-like 55..244 CDD:119339 56/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.