DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and hadhaa

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001098746.1 Gene:hadhaa / 553401 ZFINID:ZDB-GENE-031222-5 Length:761 Species:Danio rerio


Alignment Length:261 Identity:80/261 - (30%)
Similarity:137/261 - (52%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAK-NSFSRGMVETFNDVLEDIKKDNGSRV 86
            |:|:.::.....|.|..|    .:..::|:.:|.|.:| |:.|:.|.....:|:.::..::..:.
Zfish    25 RSLSVSSAVLARTHVSYE----VKDNVAVVRINDPTSKVNTLSKHMQAEMVEVMNEVWGNSSVKS 85

  Fly    87 VVLRSLSPGIFCAGADLKERKG-MTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEM 150
            .||.|..||.|.||||:...:. .|.||.|...:..:.:...||:.|:|::||::|:.||||||.
Zfish    86 AVLISRKPGCFIAGADINMIQACTTAEEVTSLSQAGQKMFEQIEKSPIPIVAAINGSCLGGGLEF 150

  Fly   151 ALACDIR--TAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGL 213
            |:||..|  |.:..|.:|..|..|.::||||||||||:::....|.:::.|.|.....:||.:||
Zfish   151 AIACQYRIATKSKKTVLGTPEVMLGLLPGAGGTQRLPKMVGLPAAFDMMLTGRNIRADKAKKMGL 215

  Fly   214 VNHVV-------KQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKG---MQ--VDLATGYS 266
            |:.:|       |..|      ::.::..||:..:...|:...|:.::|.   ||  .|...|.|
Zfish   216 VHQLVDPLGPGLKSPE------ERTIEYLEEVAVDFAKGLAAKKVTLEKKKGLMQKVQDFVMGLS 274

  Fly   267 I 267
            :
Zfish   275 L 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 75/236 (32%)
hadhaaNP_001098746.1 fa_ox_alpha_mit 25..760 CDD:131494 80/261 (31%)
crotonase-like 39..249 CDD:119339 69/219 (32%)
3HCDH_N 361..539 CDD:280833
3HCDH 542..637 CDD:279114
3HCDH 674..>750 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.