DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and auh

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001119537.1 Gene:auh / 548406 XenbaseID:XB-GENE-963000 Length:322 Species:Xenopus tropicalis


Alignment Length:273 Identity:169/273 - (61%)
Similarity:211/273 - (77%) Gaps:1/273 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRS 91
            |:|..|: .|:.|..|:|..|||.|:|:|||.|||:.|:|:|::...:::.:|.:|..|.|||||
 Frog    51 SSAEKGE-DELRVRYLEGDDQGIVVLGINRPQAKNAISKGLVKSMMKMIDSLKGNNKVRTVVLRS 114

  Fly    92 LSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDI 156
            ..||:||||||||||..|.|.|...||.:.|.|:.....||||.|||:||||||||||||:||||
 Frog   115 EVPGVFCAGADLKERAKMHPSEVGPFVTKARALMNEFANLPMPTIAALDGAALGGGLEMAMACDI 179

  Fly   157 RTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQN 221
            ..|||..|||||||:|||||||||||||||.:..||||||||:|||.:|.|||.||||:|||:||
 Frog   180 IVAASSAKMGLVETKLAIIPGAGGTQRLPRAVGVALAKELIFSARVLDGNEAKSLGLVSHVVEQN 244

  Fly   222 ETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLA 286
            :..|||:::|:.||.|..|.||:.:|||||||::|::||||||.:|||.||:|:||||||:|||.
 Frog   245 DAGDAAFKRAVALAREFTPQGPIALRMAKLAINQGIEVDLATGLAIEEACYAQIIPTKDRIEGLL 309

  Fly   287 AFAEKRKPVYKGE 299
            ||.|||.|.||||
 Frog   310 AFKEKRPPRYKGE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 159/250 (64%)
auhNP_001119537.1 crotonase-like 68..322 CDD:390041 160/253 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 321 1.000 Domainoid score I1228
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1284
Inparanoid 1 1.050 329 1.000 Inparanoid score I2415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1123666at2759
OrthoFinder 1 1.000 - - FOG0002752
OrthoInspector 1 1.000 - - oto102513
Panther 1 1.100 - - LDO PTHR11941
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3547
SonicParanoid 1 1.000 - - X1838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.