DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and zgc:101569

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001005995.2 Gene:zgc:101569 / 449822 ZFINID:ZDB-GENE-041010-72 Length:309 Species:Danio rerio


Alignment Length:209 Identity:76/209 - (36%)
Similarity:109/209 - (52%) Gaps:11/209 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGI 96
            |....|:.||    |..:.:||:|||.|:|:.:|...:...:.|....:|:...|.||..:. |.
Zfish    44 GSNGPVVSER----RGAVMLIGINRPEARNAVNRETAQRLTEELSAFDQDDSLNVTVLYGVG-GN 103

  Fly    97 FCAGADLKE-RKGMTPEEATEFVKELRGLL-IAIEQLPMPVIAAVDGAALGGGLEMALACDIRTA 159
            ||||.|||| ..|....|..:.|....|.: .:..:|..|:||||.|.|:.||||:||..|:|.|
Zfish   104 FCAGFDLKELAHGSDSLELEQDVSSGPGPMGPSRMRLSKPLIAAVSGYAVAGGLELALLADMRVA 168

  Fly   160 ASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQ 224
            ...:.||:...|..:....|||.|||:::..:.|.:||.|.|.....||...||.|.||...:  
Zfish   169 EESSIMGVFCRRFGVPLIDGGTVRLPQLIGLSRALDLILTGRPVKAHEALAFGLANRVVPDGQ-- 231

  Fly   225 DAAYQQALKLAEEI 238
              |.|:||:|||::
Zfish   232 --ALQEALELAEQV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 71/193 (37%)
zgc:101569NP_001005995.2 PRK08259 46..304 CDD:236205 75/207 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.