DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CG5611

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001263016.2 Gene:CG5611 / 43318 FlyBaseID:FBgn0039531 Length:326 Species:Drosophila melanogaster


Alignment Length:282 Identity:85/282 - (30%)
Similarity:125/282 - (44%) Gaps:28/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVASRNLASAAPYG-DGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDN 82
            |...||..|.:..| ....||||:    ...|::|||||...:||......|...:.:...:.|:
  Fly    24 LATVRNAESESQEGAPARTVLVEK----DSHITLIGLNREQQRNSIDANTAEQLTEAISQFEADD 84

  Fly    83 GSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQ-LPMPVIAAVDGAALGG 146
            .|.|.||..:. |.||||.||:|.:......:..|:....|.:....: |..|::..:.|..:.|
  Fly    85 TSPVGVLYGIG-GSFCAGYDLEELEAEAQRGSLNFLLRHEGSVGPTRRHLRKPLVCGISGFCVAG 148

  Fly   147 GLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDL 211
            |||:||.||:|.......:|....||.:....|||.||...:..:.|.|:|.|.|.....||:.:
  Fly   149 GLELALMCDLRVMEDTAVLGFFNRRLGVPLSDGGTVRLAAAVGYSNALEIIATGRRIYSGEARRI 213

  Fly   212 GLVNHVVKQNETQDAAYQQALKLAEEI--LPNGPVGVRMAKLAIDKGMQVDLATGYS---IEEIC 271
            ||||.||    ....|..||:.||..|  .|       ||.|..|:...::.|..|:   .....
  Fly   214 GLVNRVV----ATGTALGQAVNLAFSIAKFP-------MASLMHDRNAVLENANAYNKPGFHVAS 267

  Fly   272 YSQVI-PTKDRL----EGLAAF 288
            |:::: .|.|.:    ||:..|
  Fly   268 YNEIMNVTSDMITDMQEGVKRF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 76/252 (30%)
CG5611NP_001263016.2 crotonase-like 39..256 CDD:304874 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451198
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2195
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.