DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CG5044

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:110/270 - (40%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PLVASRNLASAAPYGDGTEV-----LVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLED 77
            |::....::...|......|     .|...:.:.:|:.:  ||||.|.|:.:..||   ..:.:.
  Fly    21 PMIGGATISQTKPTTMALSVRQSSSSVLATESSNKGMII--LNRPKALNAINLEMV---RKIYKH 80

  Fly    78 IKK-DNGSRVVVLRSLSPGIFCAGADLKERKGMTP-EEATEFVKELRGLLIAIEQLPMPVIAAVD 140
            :|| :....:|:::......||||.|::......| :|:..|.:|.......|....:|.||.:|
  Fly    81 LKKCEKSKSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKSFFREEYSTNALIGNYKIPYIAIID 145

  Fly   141 GAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNG 205
            |..:|||:.:::....|.|:..|...:.||.:.:.|..||:..||| |...|...|..|.....|
  Fly   146 GITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFPDVGGSYFLPR-LQGKLGLYLGLTGYRLRG 209

  Fly   206 AEAKDLGLVNHVVKQNETQDAAYQQALKLA----------EEIL------PNGPVGVRMAKLAID 254
            |:....|:..|..:.::..|      |:.|          .|:|      |..|..::.....|:
  Fly   210 ADVYYSGIATHYCESSKIPD------LETALLNCPDADDVPELLQKYHSPPEKPFSLQPVLEQIN 268

  Fly   255 KGMQVDLATG 264
            |....|...|
  Fly   269 KNFSADSVEG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 60/235 (26%)
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 61/247 (25%)
ECH_2 56..374 CDD:292731 60/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451197
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.