DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and HIPP1

DIOPT Version :10

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster


Alignment Length:238 Identity:50/238 - (21%)
Similarity:93/238 - (39%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASRNLASAAPYGDGTE-VLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGS 84
            :|..||:.....:|:| |.:.:::  :....||...|....:::|:.::|..||.|..:.:....
  Fly   654 SSHTLANDMKANNGSELVCLHKVN--KVAHLVIHTERGNFGHTYSKQLLEQLNDTLSSVARKGEF 716

  Fly    85 RVVVLRSLSPGIFCAGAD--------LKERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDG 141
            ..|:|....|. ||.|.|        |::||    :.|::....|:..|..:...|.|::|.:.|
  Fly   717 NTVLLTVEGPQ-FCQGIDCQELIQGSLEKRK----DSASQLAVALKCYLRTLATFPKPLVAGIVG 776

  Fly   142 AALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGA----GGTQRL------------PRILSP 190
            :.:..|:......|...|:.|........:|..:|..    .|.||:            .|:.:.
  Fly   777 SQINLGVMQLPFADYVVASDDCSFETNYAKLGQLPEGYALWHGHQRVSSEVHSRLFLMGERLFAT 841

  Fly   191 ALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALK 233
            .|.:...|..::.......::.|..  .||..|..|...:.||
  Fly   842 ELLESNSFVDKICKARNVNEMALAK--AKQISTSSAEMYRTLK 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:474030 44/210 (21%)
HIPP1NP_649261.1 PTZ00449 <148..580 CDD:185628
crotonase-like 673..870 CDD:119339 39/205 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.