DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Echs1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:296 Identity:102/296 - (34%)
Similarity:150/296 - (50%) Gaps:14/296 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RASGLARQLAR-PLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVET 70
            ||..:.:..|| |.||:|  .|::...:..|.:...:.|..:.:.||.||||.|.|:...|:::.
  Fly    11 RAQCVLQAAARQPQVATR--FSSSSTNNNWEYIKTEVAGEGKNVGVITLNRPKALNALCNGLMKE 73

  Fly    71 FNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATE--FVKELRGLLIAIEQLPM 133
            .:..|:...||.....:||.. |...|.||||:||..|.|..:..:  |:.:    ...:.:...
  Fly    74 LSTALQQFSKDKTISAIVLTG-SEKAFAAGADIKEMVGNTYSQCIQGNFLND----WTEVARTQK 133

  Fly   134 PVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIF 198
            |:||||:|.|||||.|:|:.|||..|....|.|..|..|..||||||||||.|::..:.|.|:..
  Fly   134 PIIAAVNGYALGGGCELAMMCDIIYAGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCL 198

  Fly   199 TARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDLAT 263
            |..:....||:.|||.:.||    ..|....:|:||.|:|..:..:.|::.|.|::...:..|..
  Fly   199 TGNMIGAQEAEKLGLASKVV----PADQLLGEAVKLGEKIGTHSNLIVQLCKEAVNTAYETTLQE 259

  Fly   264 GYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYKGE 299
            |...|...:.....|.||.||:.||||||...:..|
  Fly   260 GLKFERRTFHATFSTADRKEGMTAFAEKRPAKFTNE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 90/252 (36%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 92/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.