DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Echdc1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001007735.1 Gene:Echdc1 / 361465 RGDID:1359654 Length:299 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:123/271 - (45%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPG----------I 96
            |...:.||.::.||.....|:||..|:   ..:||        ||:.|.:.:.|          .
  Rat    49 LQKKQNGIGILTLNNSNKMNAFSGAMM---LQLLE--------RVIELENWTEGKGLIVHGAKNT 102

  Fly    97 FCAGADLKERKGM-TPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAA 160
            ||:|:||...|.: |||........::..|....:||:..:|.|.|.|:|||.|:..|||.|...
  Rat   103 FCSGSDLNAVKALSTPENGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMT 167

  Fly   161 SDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQD 225
            .::.:..|...:.|:|..||..||..|:....|.:::......:..||..:||.:.|::.:: :.
  Rat   168 EESVIRFVHKEMGIVPSWGGASRLVEIIGSRQALKVLSGTFKLDSKEALRIGLADEVLQPSD-EA 231

  Fly   226 AAYQQALKLAEEILPNGPVGV-RMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLE------ 283
            .|.:||.:..|:.: :||..| |..|.::..|.::.|      ||...::    :|.||      
  Rat   232 TALEQAQEWLEQFV-SGPAQVIRGLKKSVCSGRELYL------EEALQNE----RDVLETLWGGP 285

  Fly   284 -GLAAFAEKRK 293
             .|.|.|:|.|
  Rat   286 ANLEAIAKKGK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 73/265 (28%)
Echdc1NP_001007735.1 crotonase-like 52..243 CDD:119339 55/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.