DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Cdyl

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:247 Identity:57/247 - (23%)
Similarity:103/247 - (41%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVV 87
            |...||..|.|   ::|.:.||...   ::...:.:..||.:..:::.....|.....|: |::|
  Rat   352 RQTESAYRYRD---IVVRKQDGFTH---ILLSTKSSENNSLNPEVMKEVQSALSTAAADD-SKLV 409

  Fly    88 VLRSLSPGIFCAGADL--------KERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAAL 144
            :|.::. .:||.|.|.        .:||    .|:|:..:.:|..:....|...|:|.||:|.|:
  Rat   410 LLSAVG-SVFCCGLDFIYFIRRLTDDRK----RESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAI 469

  Fly   145 GGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAK 209
            |.|..:...||:..|..........|.....|....|...|:|:..|.|.|::.:.|.....||.
  Rat   470 GLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEAC 534

  Fly   210 DLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDL 261
            ..|||:.|.    ......|:.:...:|:....|:.:..:|..:...|:::|
  Rat   535 GKGLVSQVF----WPGTFTQEVMVRIKELASCNPIVLEESKALVRCNMKMEL 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 49/222 (22%)
CdylXP_017456089.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.