DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CG4598

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster


Alignment Length:260 Identity:60/260 - (23%)
Similarity:111/260 - (42%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMT 110
            :.||:.:.:|||.. |..:..:::.....:::| :.|.||.::|.|.|..||.||.|:.|.....
  Fly    33 KTGIATLTMNRPPV-NGLNLELLQDLKSSIDEI-ESNKSRGLILTSSSSTIFSAGLDILEMYKPD 95

  Fly   111 PEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAII 175
            .:....|..:|:...:|:....:|..||::|.:..||..:|.:|:.|....:..:||.||:|.|:
  Fly    96 KDRIRAFWTQLQDTWLALYGSSVPTAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIV 160

  Fly   176 PGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILP 240
            ...........:|...:|:..:...|:|...||..:||::......|   .|.::.:........
  Fly   161 APQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANNKE---EAIEKCVAFIGTFAK 222

  Fly   241 NGPVGVRMAK--------LAIDKGMQVDLATGYSIEEICYSQVIPTKDR-----LEGLAAFAEKR 292
            ..|:...:.|        ..:..|.:.||      |:..:....|...:     ||||...|:|:
  Fly   223 VNPLARSLTKQQFRAADLQQLQNGRKEDL------EKFLFFVNQPAVQKGLGIYLEGLKKKAKKQ 281

  Fly   293  292
              Fly   282  281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 60/258 (23%)
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451151
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.