DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and eci1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001292513.1 Gene:eci1 / 334101 ZFINID:ZDB-GENE-030131-6033 Length:301 Species:Danio rerio


Alignment Length:261 Identity:64/261 - (24%)
Similarity:118/261 - (45%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSR 85
            |.|.|.|...|...:::.|: ||.: .|::|:....|.. ||.|...:..|...||.::.|...|
Zfish    30 ALRYLVSKNDYSTSSKIKVD-LDSS-NGVAVLQFQSPPV-NSLSLDFLTEFAINLEKLELDRSCR 91

  Fly    86 VVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEM 150
            .|::.|..|.:|.||.|:.|....:||...||.|.::...:.:.......|||::|.:..||..:
Zfish    92 GVIITSAQPKVFSAGLDILEMYQKSPEHCAEFWKAVQEAWLKLYGSSKVTIAAINGNSPAGGCLL 156

  Fly   151 ALACDIRTAASDTK--MGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGL 213
            |:.||.|..|.:.:  :||.||:|.|:........:..::.....::.:....::|...|..:||
Zfish   157 AMCCDYRIMADNPRYSIGLNETQLGIVAPFWFKDTMLNVVGHRETEKGLQLGLLYNTPNALKIGL 221

  Fly   214 VNHVVKQNETQDAAYQ----------QALKLAEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIE 268
            |:.:|.:::....|.:          .|.::::.::....|...:|....|....|...|..||:
Zfish   222 VDELVPEDKVLSTAAETMTKWLAIPDHARQISKSMMRKPTVDKLLANREADTTNFVSFITKDSIQ 286

  Fly   269 E 269
            :
Zfish   287 K 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 56/234 (24%)
eci1NP_001292513.1 crotonase-like 53..297 CDD:304874 56/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.