DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CG9577

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster


Alignment Length:316 Identity:83/316 - (26%)
Similarity:139/316 - (43%) Gaps:29/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MLIKRASGLARQLARP-----LVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNS 62
            |.:.|.:.|.:...:|     |...|||::....|.........:...:..:..:.|:||:..|:
  Fly     1 MSLSRLNTLMKLTPKPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKPFVFHVELHRPSKFNA 65

  Fly    63 FSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKE---------------RKGMTPE 112
            .|:.|.....:..:.:..:...|.:|| |.|...|.||.||.:               |||::.|
  Fly    66 ISKQMWLEIKECFDGLATNPDCRAIVL-SASGKHFTAGIDLNDMINVGQTLAETDDYARKGVSME 129

  Fly   113 EATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPG 177
               ..:|..:..:.::|..|.|||.||..|.:|.|:::..|.|||....|....:.|..:.:...
  Fly   130 ---RMIKVYQDSISSLEHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAAD 191

  Fly   178 AGGTQRLPRIL-SPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPN 241
            .|..||||:.: |.:||:||.||.|.|..|||...|||:.:...   :|:....||.:||.|...
  Fly   192 VGTLQRLPKAVGSQSLARELCFTGRKFEAAEAHSSGLVSRLFPD---KDSLLTGALAVAELIASK 253

  Fly   242 GPVGVRMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAA-FAEKRKPVY 296
            .||.|:..|.::...::.....|.....:.....:.::|..:.:|| ..:..|||:
  Fly   254 SPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLLSEDFAQAVAAQLTKDDKPVF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 74/266 (28%)
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 74/265 (28%)
PRK05617 54..309 CDD:235533 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.