DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CG14787

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster


Alignment Length:236 Identity:50/236 - (21%)
Similarity:86/236 - (36%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLR---------S 91
            |::||:    |.|:..|...|     .:.|..:......|:....|...:||||.         .
  Fly    12 ELVVEQ----RSGLLHIRFQR-----RWQRRTLYELMRALDLASADAAVKVVVLSGEFSAACGGE 67

  Fly    92 LSPGIFCAGADLKERKGMTPEEAT-------EFVKE------LRGL---LIAIEQLPMPVIAAVD 140
            :.|.....|.:.:.|:..:.|||.       :::.|      :|.|   |:...:|   ::|.|:
  Fly    68 MEPLALKQGLENRSRRTASHEEAVGSGDAEEQYIHEKAANFVMRSLAKKLLVHRKL---LVAFVE 129

  Fly   141 GAALGGGLEMALACDIRTAASDTKMGLVETRL-AIIP-----------GAGGTQRLPRILSPALA 193
            ...:|.||.:...||:          :..|.| |.:|           |.|.|  :|.:      
  Fly   130 RQCVGLGLSVCSLCDL----------VFATELSAFVPAFSHLDPCTKVGPGWT--VPHV------ 176

  Fly   194 KELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKL 234
            ..|:......:.:.|...|||..||::.:.......|.|:|
  Fly   177 HWLLRLGDQASSSIALQCGLVASVVREPQEFWHRVDQYLRL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 46/224 (21%)
CG14787NP_569914.2 crotonase-like 13..216 CDD:304874 47/232 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.