DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Hibch

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006244957.1 Gene:Hibch / 301384 RGDID:1308392 Length:385 Species:Rattus norvegicus


Alignment Length:240 Identity:65/240 - (27%)
Similarity:104/240 - (43%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVE 69
            |:|||.:.:.|.    .|::..:|       |||:||    |....||.||||...|:.|..|:.
  Rat    16 IRRASVILQHLR----MSKHTETA-------EVLLER----RGCAGVITLNRPKLLNALSLNMIR 65

  Fly    70 TFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLK-----ERKGMTPEEATEFVKELRGLLIAIE 129
            .....|:..::|..:.:::::......||||.|:|     ::.|.|..:  :..:|...|..||.
  Rat    66 QIYPQLKKWERDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKAGQTLSQ--DLFREEYILNNAIA 128

  Fly   130 QLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAK 194
            ....|.:|.:||..:|||:.:::....|.|...:...:.||.:.:.|..||...||| |...|..
  Rat   129 SCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGGYFLPR-LQGKLGY 192

  Fly   195 ELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEIL 239
            .|..|.....|.:....|:..|.|...:..        .|.||:|
  Rat   193 FLALTGFRLKGRDVHRAGIATHFVDSEKLH--------VLEEELL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 52/197 (26%)
HibchXP_006244957.1 PRK05617 33..377 CDD:235533 59/219 (27%)
ECH_2 46..374 CDD:292731 52/195 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.