DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Cdyl2

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:74/155 - (47%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DVLEDIKK------DNGSRVVVLRSLSPGIFCAGADLKERKGMTP----EEATEFVKELRGLLIA 127
            ::::::::      .:.|::::|.::. .:||:|.|.....|...    :|:|...:.:|..:.|
  Rat   323 EIMKEVRRALCNAATDDSKLLLLSAVG-SVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKA 386

  Fly   128 IEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPAL 192
            ..|...|::.|::|.|||.|..:...|||..|:...........:.:.|....:...|:||..||
  Rat   387 FIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVAL 451

  Fly   193 AKELIFTARVFNGAEAKDLGLVNHV 217
            |.|::|..|.....||...|||:.|
  Rat   452 ANEMLFCGRKLTAQEACSRGLVSQV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 39/155 (25%)
Cdyl2XP_017456726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.