DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Eci2

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:277 Identity:67/277 - (24%)
Similarity:115/277 - (41%) Gaps:33/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ARQLARPLVASRNLAS-AAPYGDGTEVLVERLDGARQ-----------GISVIGLNRPAAKNSFS 64
            |||....||:|.:.:| |:..|.|      ..||..|           ||:.|..|||:.||:.:
  Rat   105 ARQNYVDLVSSLSSSSEASSQGKG------GADGKAQESKGILVTSEGGITKITFNRPSKKNAIT 163

  Fly    65 RGMVETFNDVLEDIKKDNGSRVVVLRSLSPG-IFCAGADL---KERKGMTPEEATEFVKELRGLL 125
               .:.:.|::..:|..:....|:......| .:.:|.||   ....|...|.|.:....||..:
  Rat   164 ---FQMYQDIILALKNASTDDTVITVFTGAGDYYSSGNDLTNFTSASGGMEEAANKGAIVLREFV 225

  Fly   126 IAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSP 190
            ......|.|::|.|:|.|:|..:.:....|...|:.........:.|...|.|..:...|:::..
  Rat   226 NTFIDFPKPLVAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEACSSYTFPKMMGS 290

  Fly   191 ALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDK 255
            |.|.|::...:.....||...|||..|..::..:...:.: ||...::.||   .:|::|..|.|
  Rat   291 AKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTR-LKTYAKLPPN---SMRISKELIRK 351

  Fly   256 GMQVDLATGYSI-EEIC 271
            ..:..|   ::: ||.|
  Rat   352 NEKEKL---HAVNEEEC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 54/229 (24%)
Eci2NP_001006967.1 ACBP 38..113 CDD:279259 3/7 (43%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68
crotonase-like 134..389 CDD:304874 55/242 (23%)
ECH-like 149..319 40/172 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.