DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and HIBCH

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_055177.2 Gene:HIBCH / 26275 HGNCID:4908 Length:386 Species:Homo sapiens


Alignment Length:208 Identity:53/208 - (25%)
Similarity:91/208 - (43%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EVLVERLDGARQGIS-VIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCA 99
            |||:|     ::|.: ||.||||...|:.:..|:......|:..::|..:.:::::......|||
Human    37 EVLLE-----KKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCA 96

  Fly   100 GADLK---ERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAAS 161
            |.|::   |.:....:.|..|.:|...|..|:.....|.:|.:.|..:|||:.:::....|.|..
Human    97 GGDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATE 161

  Fly   162 DTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDA 226
            .....:.||.:.:.|..||...||| |...|...|..|.....|.:....|:..|.|..      
Human   162 KCLFAMPETAIGLFPDVGGGYFLPR-LQGKLGYFLALTGFRLKGRDVYRAGIATHFVDS------ 219

  Fly   227 AYQQALKLAEEIL 239
              ::...|.|::|
Human   220 --EKLAMLEEDLL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 49/196 (25%)
HIBCHNP_055177.2 PRK05617 34..378 CDD:235533 53/208 (25%)
ECH_2 47..375 CDD:292731 48/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.