DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Hibch

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_666220.1 Gene:Hibch / 227095 MGIID:1923792 Length:385 Species:Mus musculus


Alignment Length:304 Identity:76/304 - (25%)
Similarity:124/304 - (40%) Gaps:32/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVET 70
            :|||.:.:.|...:           :.:..|||:||    |....||.||||...|:.|..|:..
Mouse    17 RRASVILQHLRMSM-----------HTEAAEVLLER----RGCGGVITLNRPKFLNALSLNMIRQ 66

  Fly    71 FNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLK---ERKGMTPEEATEFVKELRGLLIAIEQLP 132
            ....|:..::|..:.:::::......||||.|:|   |.|........:..:|...|..||....
Mouse    67 IYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALSEAKKARQNLTQDLFREEYILNNAIASCQ 131

  Fly   133 MPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELI 197
            .|.:|.:||..:|||:.:::....|.|...:...:.||.:.:.|..||...||| |...|...|.
Mouse   132 KPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPDVGGGYFLPR-LQGKLGYFLA 195

  Fly   198 FTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKL----AEEILPNGPVGVRMAKLAIDKGMQ 258
            .|.....|.:....|:..|.| .:|......::.|.|    ||::.  |.:....||..:|:...
Mouse   196 LTGYRLKGRDVHRAGIATHFV-DSEKLRVLEEELLALKSPSAEDVA--GVLESYHAKSKMDQDKS 257

  Fly   259 VDLATGYSIEEICYS-----QVIPTKDRLEGLAAFAEKRKPVYK 297
            :...........|:|     |:|... |.:|.....|:.|.:.|
Mouse   258 IIFEEHMDKINSCFSANTVEQIIENL-RQDGSPFAIEQMKVINK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 66/262 (25%)
HibchNP_666220.1 PRK05617 33..377 CDD:235533 72/277 (26%)
ECH_2 46..374 CDD:292731 66/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.