DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and EHHADH

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001957.2 Gene:EHHADH / 1962 HGNCID:3247 Length:723 Species:Homo sapiens


Alignment Length:287 Identity:76/287 - (26%)
Similarity:128/287 - (44%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKE 105
            ||..|   :::|.|..|.. |:.|..::....:.|:....|:..:.:|:.. :.|.|.||||:  
Human     6 RLHNA---LALIRLRNPPV-NAISTTLLRDIKEGLQKAVIDHTIKAIVICG-AEGKFSAGADI-- 63

  Fly   106 RKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVET 170
             :|.:....  |...|..::..|::...||:||:.|.|.|||||:||.|..|.|.::.::||.|.
Human    64 -RGFSAPRT--FGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEV 125

  Fly   171 RLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLA 235
            .|.::|||.|||.|||:.....|.:||.:.|.....||..||:::.||..:..     ::|::.|
Human   126 TLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPV-----EEAIRFA 185

  Fly   236 EEI-----------------LPN-----------------GPVGVRMAKLAIDKGMQVDLATGYS 266
            :.:                 |||                 |.:.......|:...:|.....|..
Human   186 QRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIK 250

  Fly   267 IEEICYSQVIPT-KDRLEGLAAFAEKR 292
            .||..:..::.: :.|....|.|||::
Human   251 KEEELFLYLLQSGQARALQYAFFAERK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 73/280 (26%)
EHHADHNP_001957.2 Enoyl-CoA hydratase / isomerase 1..282 76/287 (26%)
fadJ 20..705 CDD:333311 70/270 (26%)
3-hydroxyacyl-CoA dehydrogenase 283..572
Microbody targeting signal 721..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.