DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and B0272.4

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_509583.1 Gene:B0272.4 / 181892 WormBaseID:WBGene00007130 Length:255 Species:Caenorhabditis elegans


Alignment Length:253 Identity:64/253 - (25%)
Similarity:105/253 - (41%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGA 101
            :|.||    :..:..:.||||...|:.:|.|......|..|...|:....||........:|||:
 Worm     6 ILTER----KNNVLWVTLNRPKKFNALTRQMFLDLCTVFNDAADDDDIAFVVFTGGKGKYYCAGS 66

  Fly   102 DLKERKGMTPEEATEF-VKELRGLLIAIEQLPMPVIAAVDGAALG------GGLEMALACDIRTA 159
            |....:..|..:..|. .|....:|||   .|.|:||.|:|.|:|      |.::..:|.|..|.
 Worm    67 DFSPAELSTLTDIQEHGYKLFVDILIA---FPKPIIALVNGHAVGVSVTMLGVMDAVIAIDTATF 128

  Fly   160 ASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQ 224
            |:..      ..:.:.|.|..:..||||:....|..|:..:..|...||...|||..::..    
 Worm   129 ATPF------ADIGVCPEACSSYTLPRIMGHQKAAALMMFSEKFTAHEAHIAGLVTQILPA---- 183

  Fly   225 DAAYQQ-ALKLAEEILPNGPVGVRMAK------------LAIDKGMQVDLATGYSIEE 269
             |.::: |.|:.:......|:.:::||            |.:::..||.|...:|.|:
 Worm   184 -ATFEKDAKKIIDRYSKLSPITMKVAKELMRTTQIKDELLTVNRKEQVHLNGMFSHED 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 61/242 (25%)
B0272.4NP_509583.1 crotonase-like 6..196 CDD:119339 55/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.