DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ech-3

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_505066.1 Gene:ech-3 / 179180 WormBaseID:WBGene00001152 Length:258 Species:Caenorhabditis elegans


Alignment Length:261 Identity:77/261 - (29%)
Similarity:127/261 - (48%) Gaps:26/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKE 105
            |.||.   :.:||:||...||..:........|..|...:|:..:..||.. ..|.||||.||:.
 Worm    10 RQDGP---VFLIGINRANKKNCVNHATALQLIDAFEKFNEDSTMKTAVLYG-EGGTFCAGYDLES 70

  Fly   106 -RKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVE 169
             .|....|.:.:|..:.|.:..:|.::..|:|||::|.|:.||||::|..|:|.::...|.|:..
 Worm    71 VSKAEHQEVSEDFCDKYRYMGPSIMKIKKPLIAAIEGFAVAGGLELSLMADLRVSSPSAKFGVFC 135

  Fly   170 TRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKL 234
            .|:.:....|||.||||::....|.::|.|.|.....||...||||.:..:.:    |.::|:||
 Worm   136 RRVGVPLIDGGTVRLPRVIGLGRALDMILTGREVGAQEALQWGLVNRISDEGK----AVEEAVKL 196

  Fly   235 AEEILPNGPVGVRMAKLAIDKGMQVDLATGYSIE-------EICYSQVIPTKDRLEGLAAFAEKR 292
            . :::.:.|   .:..|| |:.     :|.||:|       |..:.......:.::|...|.||:
 Worm   197 G-KLIASHP---EICMLA-DRE-----STYYSLEHTEHESFEYEFGSTKVLAESIKGAQQFMEKQ 251

  Fly   293 K 293
            |
 Worm   252 K 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 74/254 (29%)
ech-3NP_505066.1 crotonase-like 7..247 CDD:304874 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.