DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ech-8

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_501876.2 Gene:ech-8 / 177905 WormBaseID:WBGene00001157 Length:437 Species:Caenorhabditis elegans


Alignment Length:53 Identity:11/53 - (20%)
Similarity:23/53 - (43%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PEEATEFVKEL------------RGLLIAIEQLPMPVIAAVDGAALGGGLEMA 151
            |:...:::.|.            ||..|..:.:|:..:|.:.|..:|.|:.:|
 Worm     5 PQAVRDYLMEAHQLAAQWSLPNDRGDYINSKSIPIKSVAVIGGGTMGRGIAIA 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 11/53 (21%)
ech-8NP_501876.2 FadB 38..312 CDD:224170 6/20 (30%)
3HCDH_N 41..220 CDD:280833 5/17 (29%)
3HCDH 223..310 CDD:279114
3HCDH 347..>391 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.