DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ech-6

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001366674.1 Gene:ech-6 / 176376 WormBaseID:WBGene00001155 Length:288 Species:Caenorhabditis elegans


Alignment Length:299 Identity:108/299 - (36%)
Similarity:156/299 - (52%) Gaps:17/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SMLIKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRG 66
            |||::.|. |...:.:..||:  .:|.||    ..:.:|:: |.:|.:::|.||||.|.|:....
 Worm     6 SMLVRNAK-LCANVNQMQVAA--FSSKAP----EMIKIEKV-GEKQNVALIKLNRPKALNALCAQ 62

  Fly    67 MVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEE-ATEFVKELRGLLIAIEQ 130
            ::....|.||.:..|.....:|:.. |...|.||||:||   ||..| ||.|.........|:..
 Worm    63 LMTELADALEVLDTDKSVGAIVITG-SERAFAAGADIKE---MTNNEFATTFSGSFLSNWTAVSD 123

  Fly   131 LPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKE 195
            :..||||||:|.|||||.|:|:.|||..|....:.|..|..:..|||||||||..|....:.|.|
 Worm   124 VKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARAAGKSFAME 188

  Fly   196 LIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVD 260
            :..|.......|||:.|:|:.:.    ..|....:|:||.|:|....|:.|:|||.|::|..::.
 Worm   189 VCLTGNHVTAQEAKEHGIVSKIF----PADQVVGEAVKLGEKIADQSPLIVQMAKEAVNKAYELT 249

  Fly   261 LATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYKGE 299
            |..|...|...:.....||||.||:.||||||||.::.:
 Worm   250 LQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQWESK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 95/251 (38%)
ech-6NP_001366674.1 crotonase-like 32..284 CDD:419961 97/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.