DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and ech-1.2

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_491789.1 Gene:ech-1.2 / 172310 WormBaseID:WBGene00020347 Length:781 Species:Caenorhabditis elegans


Alignment Length:301 Identity:86/301 - (28%)
Similarity:148/301 - (49%) Gaps:28/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSMLIKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQG-ISVIGLNRPAAK-NSF 63
            :|.|:.::|    ...|..::.|..:.:||....|    .|::  :|| ::|:.::.|..| |..
 Worm    28 LSRLVHQSS----STLRTNLSFRLFSQSAPAMQTT----HRVE--KQGDVAVVKIDLPNTKENVL 82

  Fly    64 SRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFV-KELRGLLIA 127
            ::.:.......|:.::.|...:.:|:.|..|..|.||||::..|......|||.: :|.:.....
 Worm    83 NKALFAEMKATLDKLQSDESIKSIVVMSGKPNSFVAGADIQMIKAEGTATATETLSREGQEQFFR 147

  Fly   128 IEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTK--MGLVETRLAIIPGAGGTQRLPRILSP 190
            ||:...||:||:.|:.:|||||:||||..|.|.:|.|  :.|.|..|.::||||||||||::.:.
 Worm   148 IEKSQKPVVAAIMGSCMGGGLELALACHYRIAVNDKKTLLSLPEVMLGLLPGAGGTQRLPKLTTV 212

  Fly   191 ALAKELIFTARVFNGAEAKDLGLVNHVVK---------QNETQDAAYQQALKLAEEILPNGPVGV 246
            ....:|..|.:.....:||.:|:|:.|::         ...|.....:.|:|.|:| |.||.:.:
 Worm   213 QNVLDLTLTGKKIKADKAKKIGIVDRVIQPLGDGLGPAAENTHKYLEEIAVKAAQE-LANGKLKI 276

  Fly   247 RMAKLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAA 287
            ...|..:.|..|..:.....::.:....   .||:|..|.|
 Worm   277 NRDKGFMHKATQAVMTNSLFLDNVVLKM---AKDKLMKLTA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 76/254 (30%)
ech-1.2NP_491789.1 fa_ox_alpha_mit 46..780 CDD:131494 82/279 (29%)
crotonase-like 60..269 CDD:119339 67/211 (32%)
3HCDH_N 381..559 CDD:280833
3HCDH 561..656 CDD:279114
3HCDH 694..780 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.