DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Hadha

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_570839.2 Gene:Hadha / 170670 RGDID:620512 Length:763 Species:Rattus norvegicus


Alignment Length:308 Identity:94/308 - (30%)
Similarity:148/308 - (48%) Gaps:53/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVASRNLASAAPYG---------------DGTEVLVERLD---GARQGISVIGLNRPAAK-NSFS 64
            :||||.:.|.:.:.               ..:..|:.|..   |.:..::||.:|.|.:| |:.:
  Rat     1 MVASRAIGSLSRFSAFRILRSRGCICHSFTTSSALLSRTHINYGVKGDVAVIRINSPNSKVNTLN 65

  Fly    65 RGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKG-MTPEEATEFVKELRGLLIAI 128
            :.:...|.:|:.:|..::..|..||.|..||.|.||||:..... .||:||....:|.:.:...:
  Rat    66 KEVQSEFVEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLASCTTPQEAARISQEGQKMFEKL 130

  Fly   129 EQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTK--MGLVETRLAIIPGAGGTQRLPRILSPA 191
            |:.|.||:||:.|:.||||||:|:||..|.|..|.|  :|:.|..|.|:||||||||||:::...
  Rat   131 EKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILPGAGGTQRLPKMVGVP 195

  Fly   192 LAKELIFTARVFNGAEAKDLGLVNHVV-------KQNETQDAAYQQALKLAEEILPNGPVGVRMA 249
            .|.:::.|.|......||.:|||:.:|       |..|      ::.::..||      |.|..|
  Rat   196 AAFDMMLTGRNIRADRAKKMGLVDQLVDPLGPGIKSPE------ERTIEYLEE------VAVNFA 248

  Fly   250 KLAIDKGMQVDLATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYK 297
            |...|:.:....:.|...:...|:..||          |.  |:.|||
  Rat   249 KGLADRKVSAKQSKGLMEKLTSYAMTIP----------FV--RQQVYK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 86/261 (33%)
HadhaNP_570839.2 fa_ox_alpha_mit 29..762 CDD:131494 89/280 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.