DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Eci1

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_034153.2 Gene:Eci1 / 13177 MGIID:94871 Length:289 Species:Mus musculus


Alignment Length:225 Identity:68/225 - (30%)
Similarity:105/225 - (46%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVASRNLASAAPYGDGTEVLVERLDGARQ--------------GISVIGLNRPAAKNSFSRGMVE 69
            |.|:|.|...|....|..   |.:||||:              |::|:.|..|.. ||.|...:.
Mouse     3 LAAARRLLLHAGSRLGRR---EAVDGARRFANKRVLVETEGPAGVAVMKLRNPPV-NSLSLECLT 63

  Fly    70 TFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQLPMP 134
            .|...||.::.|...|.|:|.|..||||.||.||.|..|..|....|:.|.::.|.:.:....|.
Mouse    64 EFTISLEKLENDKSIRGVILTSECPGIFSAGLDLLEMYGRNPAHYAEYWKNVQELWLRLYTSNMI 128

  Fly   135 VIAAVDGAALGGGLEMALACDIRTAASDTK--MGLVETRLAIIPGAGGTQRLPRILSPALAKELI 197
            :::|::||:..||..:||.||.|..|.:.|  :||.|:.|.|:............:....|:..:
Mouse   129 LVSAINGASPAGGCLLALCCDYRVMADNPKYTIGLNESLLGIVAPFWFKDMYVNTIGHREAERAL 193

  Fly   198 FTARVFNGAEAKDLGLVNHVVKQNETQDAA 227
            ....:|:.|||..:|:|:.||.:::....|
Mouse   194 QLGTLFSPAEALKVGVVDEVVPEDQVHSKA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 57/182 (31%)
Eci1NP_034153.2 ECH_1 39..285 CDD:278790 57/186 (31%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P42126 93..97 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.