DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and Cdyl

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:247 Identity:59/247 - (23%)
Similarity:103/247 - (41%) Gaps:24/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVV 87
            |...||..|.|   ::|.:.||...   ::...:.:..||.:..:::.....|.....|: |::|
Mouse   328 RQTESAYRYRD---IVVRKQDGFTH---ILLSTKSSENNSLNPEVMKEVQSALSTAAADD-SKLV 385

  Fly    88 VLRSLSPGIFCAGADL--------KERKGMTPEEATEFVKELRGLLIAIEQLPMPVIAAVDGAAL 144
            :|.::. .:||.|.|.        .:||    .|:|:....:|..:....|...|:|.||:|.|:
Mouse   386 LLSAVG-SVFCCGLDFIYFIRRLTDDRK----RESTKMADAIRNFVNTFIQFKKPIIVAVNGPAI 445

  Fly   145 GGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAK 209
            |.|..:...||:..|..........|.....|....|...|:|:..|.|.|::|:.|.....||.
Mouse   446 GLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEAC 510

  Fly   210 DLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVDL 261
            ..|||:.|.    ......|:.:...:|:....||.:..:|..:...|:::|
Mouse   511 GKGLVSQVF----WPGTFTQEVMVRIKELASCNPVVLEESKALVRCNMKMEL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 51/222 (23%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223
crotonase-like 339..535 CDD:119339 48/208 (23%)
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589 51/212 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.