DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and CDYL2

DIOPT Version :10

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:155 Identity:39/155 - (25%)
Similarity:74/155 - (47%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DVLEDIKK------DNGSRVVVLRSLSPGIFCAGADLKERKGMTP----EEATEFVKELRGLLIA 127
            ::::::::      .:.|::::|.::. .:||:|.|.....|...    :|:|...:.:|..:.|
Human   312 EIMKEVRRALCNAATDDSKLLLLSAVG-SVFCSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKA 375

  Fly   128 IEQLPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPAL 192
            ..|...|::.|::|.|||.|..:...|||..|:...........:.:.|....:...|:||..||
Human   376 FIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVAL 440

  Fly   193 AKELIFTARVFNGAEAKDLGLVNHV 217
            |.|::|..|.....||...|||:.|
Human   441 ANEMLFCGRKLTAQEACSRGLVSQV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:474030 39/155 (25%)
CDYL2XP_011521168.1 CD_CDY 42..91 CDD:349284
crotonase-like 286..482 CDD:119339 39/155 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.