DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8778 and echdc2

DIOPT Version :9

Sequence 1:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001107379.1 Gene:echdc2 / 100135206 XenbaseID:XB-GENE-948250 Length:294 Species:Xenopus tropicalis


Alignment Length:299 Identity:166/299 - (55%)
Similarity:216/299 - (72%) Gaps:5/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSMLIKRASGLARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAKNSFSR 65
            |..|::...|:.|.|...:.|.|.|:|.|     :||...||||:.:||:.|.::||.|:||..:
 Frog     1 MGSLVRLLVGVQRALPGSVWAVRRLSSGA-----SEVYAARLDGSNEGIAEIIMSRPHARNSLGK 60

  Fly    66 GMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGMTPEEATEFVKELRGLLIAIEQ 130
            ..|..|.|.::.::.|:..||||::|..|||||||||||||..|...|.:.||::||.|:..|..
 Frog    61 VFVSEFFDTVDSLRHDSSVRVVVVKSSIPGIFCAGADLKERAQMDNAEVSLFVQQLRKLMSEIAA 125

  Fly   131 LPMPVIAAVDGAALGGGLEMALACDIRTAASDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKE 195
            ||||.||||||.|||||||:|||||:|.|||..||||:||...::|||||:|||||:|...||||
 Frog   126 LPMPTIAAVDGFALGGGLELALACDLRVAASSAKMGLIETTRGLLPGAGGSQRLPRLLGIGLAKE 190

  Fly   196 LIFTARVFNGAEAKDLGLVNHVVKQNETQDAAYQQALKLAEEILPNGPVGVRMAKLAIDKGMQVD 260
            ||||.|..:|.||:.:||||..|.|||..||||.:||:||:||||..||.|||||||:::|::||
 Frog   191 LIFTGRQIDGTEAQHIGLVNDAVPQNEEGDAAYLRALELAQEILPQAPVAVRMAKLAMNRGIEVD 255

  Fly   261 LATGYSIEEICYSQVIPTKDRLEGLAAFAEKRKPVYKGE 299
            :|:|.:||.:||.|||||||||||::||.|||:|.|.|:
 Frog   256 IASGMAIEAMCYGQVIPTKDRLEGMSAFREKRQPHYTGK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 149/250 (60%)
echdc2NP_001107379.1 crotonase-like 40..294 CDD:304874 149/253 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1123666at2759
OrthoFinder 1 1.000 - - FOG0002752
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3547
SonicParanoid 1 1.000 - - X1838
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.