DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8785 and CG13743

DIOPT Version :9

Sequence 1:NP_610804.1 Gene:CG8785 / 36391 FlyBaseID:FBgn0033760 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_610444.2 Gene:CG13743 / 35911 FlyBaseID:FBgn0033368 Length:528 Species:Drosophila melanogaster


Alignment Length:526 Identity:109/526 - (20%)
Similarity:184/526 - (34%) Gaps:174/526 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AINDFNSKANLTEKELSLTDDPYHPF-------------EHRD--------PNGASAGGALAHL- 72
            |.:|||:......:.......|..|.             :||.        ...|..|..|:.| 
  Fly    34 AFDDFNNIMKNNHQTHQQQGQPQQPHQQQQQPPQQQQQQQHRQHSQQQQQAQQDAGLGDTLSSLP 98

  Fly    73 ------LKSSLGTGILAMPMAFHNAGLAFGMAMTLIVGFLCTHCVHILVKTSHDICRDAKVSALG 131
                  :.|.:|:|::.:|.|.|.||...|:|:.::|.::..:.:.::|:..| ||  .:.|..|
  Fly    99 QASFNYINSIVGSGVIGIPYALHRAGFGLGLALLILVAYITDYSLILMVRCGH-IC--GRFSYPG 160

  Fly   132 FAETAEKVFEYGPKGMRPYSNFAKQFVDIGLMATYYAAACVYIVFIATSFHDVINYDLKINWDVR 196
            ..|.|     ||..|                   ||..:.:..::   .|..:|:|::.:. |..
  Fly   161 IMEAA-----YGKYG-------------------YYLLSLLQFMY---PFLAMISYNVVVG-DTL 197

  Fly   197 IYIALTVIPCLLIGQIRDLKWLVPFSMMANIFIVVTFAITLYYMFDEPL-VYSDKPLIAKAAHIP 260
            ..:.:...|          .|   ...|..:.:.|.|.:.:..:.  || :|.:...:|:|:.|.
  Fly   198 SKVLVRFFP----------SW---GGSMGAVRLGVVFFVNVGVVM--PLCLYKNVSRLARASFIS 247

  Fly   261 L------FFATVIFAMEGIGVVMPVENSMR-KPQHFLGCPGVLNIAM------------------ 300
            |      .||.:|..|.|...|.....|.| .....:...|::..|.                  
  Fly   248 LACVVFILFAVIIKLMSGDYKVTDTAESWRFANSDLIPATGIMVFAFMCHHNTFLVYQSMRDATM 312

  Fly   301 -----VTVVSL------YAIIGFFGYVRFGDQVRGSITLNLPEGAW---LGDTAKLLMAVAILFT 351
                 ||.:|:      .|:.|..||..|....:|.:..|.   .|   |.:.:::|.:::||.|
  Fly   313 ERWEKVTHISIGFAWTVAALFGIAGYSTFRALSQGDLLENY---CWDDDLMNFSRVLFSISILLT 374

  Fly   352 FGLQFYVPNEILWRKISHKF---------------SPEK--------HNITQILLRS-------- 385
            |.::.:|..||: |.:.|:|               |.||        ..||..::.|        
  Fly   375 FPIECFVSREIV-RALVHRFVLKEPISEFTQDKDPSLEKGAIIDEYSKAITMAIVFSAFVISPMT 438

  Fly   386 ---GIILLSGGVAAAIP-----------NLEPFISL-------VGAVFFSLLGIFVPSFVETVYL 429
               |.:|...|:.||||           .:||...|       :|.|.|..|...:.:.|    |
  Fly   439 DCLGSVLELNGLLAAIPLAYILPGLAYIQMEPHALLSREKLPALGLVVFGALVTILGAAV----L 499

  Fly   430 WPDRLG 435
            .|..:|
  Fly   500 LPGLMG 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8785NP_610804.1 SdaC 60..457 CDD:223884 101/475 (21%)
SLC5-6-like_sbd 62..463 CDD:294310 101/473 (21%)
CG13743NP_610444.2 SLC5-6-like_sbd 95..500 CDD:294310 95/458 (21%)
SdaC 95..491 CDD:223884 93/445 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.