DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spt4 and SPT42

DIOPT Version :9

Sequence 1:NP_610802.1 Gene:spt4 / 36387 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_568976.1 Gene:SPT42 / 836487 AraportID:AT5G63670 Length:116 Species:Arabidopsis thaliana


Alignment Length:83 Identity:38/83 - (45%)
Similarity:57/83 - (68%) Gaps:1/83 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTTPTDSWVAKWQRL 77
            |||||.|.|||::|||...||||| .|.:|:.:.:.:.:.|:.||:|||::..|:.||.|:|.|:
plant    16 LRACLRCRLVKTYDQFRDAGCENC-PFFKMEEDHERIVEVTTPNFNGIISVMDPSRSWAARWLRI 79

  Fly    78 SRFTRGIYAISVSGTLPQ 95
            .:|..|.|.::||..||:
plant    80 GKFAPGCYTLAVSEPLPE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 38/83 (46%)
SPT42NP_568976.1 Spt4 14..110 CDD:153422 38/83 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2853
eggNOG 1 0.900 - - E1_COG5204
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2303
OMA 1 1.010 - - QHG54989
OrthoDB 1 1.010 - - D1617752at2759
OrthoFinder 1 1.000 - - FOG0003713
OrthoInspector 1 1.000 - - otm3312
orthoMCL 1 0.900 - - OOG6_102281
Panther 1 1.100 - - O PTHR12882
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2573
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.