DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spt4 and supt4h1

DIOPT Version :9

Sequence 1:NP_610802.1 Gene:spt4 / 36387 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001016679.1 Gene:supt4h1 / 549433 XenbaseID:XB-GENE-977391 Length:117 Species:Xenopus tropicalis


Alignment Length:112 Identity:68/112 - (60%)
Similarity:95/112 - (84%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFDAIPKDLRGLRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTT 65
            ||.:.:|||||.|||||:|||||:.||||.|||:||:.:|:||.|::.|||.||::||||:|:.:
 Frog     1 MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIVAMMS 65

  Fly    66 PTDSWVAKWQRLSRFTRGIYAISVSGTLPQSTLRDMKNRGIVYKSRD 112
            |.||||:||||::.|..|:||:||:|.|||..:|::|:||::|||||
 Frog    66 PDDSWVSKWQRITNFKPGVYAVSVTGRLPQGIVRELKSRGVLYKSRD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 57/96 (59%)
supt4h1NP_001016679.1 Spt4 11..108 CDD:153422 57/96 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5855
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68303
Inparanoid 1 1.050 162 1.000 Inparanoid score I4115
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1617752at2759
OrthoFinder 1 1.000 - - FOG0003713
OrthoInspector 1 1.000 - - oto105053
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2573
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.