DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spt4 and spt-4

DIOPT Version :9

Sequence 1:NP_610802.1 Gene:spt4 / 36387 FlyBaseID:FBgn0028683 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_497135.1 Gene:spt-4 / 175172 WormBaseID:WBGene00005014 Length:120 Species:Caenorhabditis elegans


Alignment Length:109 Identity:56/109 - (51%)
Similarity:81/109 - (74%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AIPKDLRGLRACLVCSLVKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTTPTDS 69
            ::|.|||.|||||:||||||.:.|:.:||||||:.|.:|.:::.|||.||.|:||:||..:..:|
 Worm     4 SVPADLRNLRACLLCSLVKSVESFQKEGCENCEDVLHLKGDEEKVYDCTSANYDGMIAAMSNNES 68

  Fly    70 WVAKWQRLSRFTRGIYAISVSGTLPQSTLRDMKNRGIVYKSRDR 113
            ||.|||::.|..:|:|||||||.||.:.:.::|:.|:.||...|
 Worm    69 WVCKWQKMQRKVKGMYAISVSGVLPNNIVSELKSLGVRYKPNQR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spt4NP_610802.1 Spt4 11..108 CDD:153422 50/96 (52%)
spt-4NP_497135.1 Spt4 10..107 CDD:153422 50/96 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162746
Domainoid 1 1.000 103 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_COG5204
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68303
Inparanoid 1 1.050 131 1.000 Inparanoid score I3190
Isobase 1 0.950 - 0 Normalized mean entropy S564
OMA 1 1.010 - - QHG54989
OrthoDB 1 1.010 - - D1617752at2759
OrthoFinder 1 1.000 - - FOG0003713
OrthoInspector 1 1.000 - - oto19324
orthoMCL 1 0.900 - - OOG6_102281
Panther 1 1.100 - - LDO PTHR12882
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1386
SonicParanoid 1 1.000 - - X2573
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.