DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and XLG2

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:395 Identity:90/395 - (22%)
Similarity:158/395 - (40%) Gaps:89/395 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KLLVLGTGESGKTTFIKQMRIIHGKGFL--DKERKQF--TKNVFQNIFMAI-------------Q 82
            |||::|:.:.|.||..||.|.::...|.  |:||.:|  ..|::..:.|.:             |
plant   464 KLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQ 528

  Fly    83 SMISAMDTLRIPYGQQEHSKL---ADLV----KSIDYKTVTRLEAPYLNAIKTLWKDAGIKECYN 140
            |..:..|......|...:.:|   :|.|    :..:.|............:..||:...|:..|.
plant   529 SSGNVGDETSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQATYK 593

  Fly   141 RRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRA--------------PTTNIVE-----Y 186
            |.|: .|..:..|||..|..|.||:|..:|.|||....              |:|:..|     |
plant   594 RLRD-TLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESLESDY 657

  Fly   187 PFNLD--GFLIRLVDVAGQRTERRKW--IHCFSNVTSIMFLVAMSEFDLSLAESEND--NRMKES 245
            ..:.|  ..||||    ..|:....|  :..|.:...::|.|:::::..::.:.|.:  |:|..:
plant   658 QHDTDMKYQLIRL----NPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNIVNKMLAT 718

  Fly   246 KALFHNIISFSWFQHSSVILFLNKEDLFKKKILSTHL--ADYFPEYN-----------GPKKDAK 297
            |.||.|:::.....:...:|.|.|.||.::||....|  .::|.::|           .|.. |:
plant   719 KQLFENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTCEWFEDFNPLISQNQTSRHNPPM-AQ 782

  Fly   298 AAREFILYMF---------------TSVNPDPYKCIYPHFTVATNTENIKFVFTAVKDTILELHL 347
            .|..:|.|.|               .|..|..:.|     .|:..::.:.......:: ||:.|:
plant   783 RAFHYIGYKFKRLYDSILEPVNMRGRSFKPKLFVC-----QVSLESDTVDNALRYARE-ILKWHV 841

  Fly   348 SETNL 352
            .||::
plant   842 EETSM 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 89/392 (23%)
G-alpha 34..347 CDD:206639 87/388 (22%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 87/387 (22%)
G-alpha 464..837 CDD:278904 85/384 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.