DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and Gna11

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_112295.1 Gene:Gna11 / 81662 RGDID:619749 Length:359 Species:Rattus norvegicus


Alignment Length:351 Identity:218/351 - (62%)
Similarity:283/351 - (80%) Gaps:0/351 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERK 67
            |||||:..|.:||:.||:|.|:.:|:.||||||||:||||||||:|||||||||||.|:.:::::
  Rat     9 CCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKR 73

  Fly    68 QFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKD 132
            .|||.|:||||.|:|:::.|||||:|.|..:::...|.|::.:|.:.||..|..|:|||||||.|
  Rat    74 GFTKLVYQNIFTAMQAVVRAMDTLKIRYKYEQNKANALLIREVDVEKVTTFEHQYVNAIKTLWSD 138

  Fly   133 AGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRL 197
            .|::|||:||||:||:||.:|:|.|:.||....|..|.||:|.||.|||.|:||||:|:..:.|:
  Rat   139 PGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRM 203

  Fly   198 VDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSS 262
            |||.|||:|||||||||.||||||||||:||:|..|.||:|:|||:||||||..||::.||||||
  Rat   204 VDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQHSS 268

  Fly   263 VILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVATN 327
            |||||||:||.:.|||.:||.|||||::||::||:|||||||.||..:|||..|.||.|||.||:
  Rat   269 VILFLNKKDLLEDKILHSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATD 333

  Fly   328 TENIKFVFTAVKDTILELHLSETNLL 353
            ||||:|||.|||||||:|:|.|.||:
  Rat   334 TENIRFVFAAVKDTILQLNLKEYNLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 210/337 (62%)
G-alpha 34..347 CDD:206639 197/312 (63%)
Gna11NP_112295.1 G_alpha 19..357 CDD:214595 210/337 (62%)
G-alpha 40..353 CDD:206639 197/312 (63%)
G1 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 41..54 11/12 (92%)
G2 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 178..186 4/7 (57%)
G3 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 201..210 5/8 (63%)
G4 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 270..277 6/6 (100%)
G5 motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01230 329..334 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.