DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnaq

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001037982.1 Gene:gnaq / 733773 XenbaseID:XB-GENE-973433 Length:359 Species:Xenopus tropicalis


Alignment Length:354 Identity:225/354 - (63%)
Similarity:288/354 - (81%) Gaps:2/354 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.||||::|.|.|||:.||::.|:.:|:.||||||||:||||||||:|||||||||||.|:.|::
 Frog     7 MACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 71

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSK-LADLVKSIDYKTVTRLEAPYLNAIKTL 129
            ::.|||.|:||||.|:|:||.|||||:||| :.||:| .|.|::.:|.:.|...|.||::|||.|
 Frog    72 KRGFTKLVYQNIFTAMQAMIRAMDTLKIPY-KYEHNKGHALLIREVDVEKVASFENPYVDAIKYL 135

  Fly   130 WKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFL 194
            |.|.||:|.|:|||||||:|||:|:|||:.||....|..:.||:|.||.|||.|:||||:|...:
 Frog   136 WNDPGIQEAYDRRREYQLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTTGIIEYPFDLQSVI 200

  Fly   195 IRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQ 259
            .|:|||.|||:|||||||||.||||||||||:||:|..|.||:|:|||:||||||..||::.|||
 Frog   201 FRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ 265

  Fly   260 HSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTV 324
            :|||||||||:||.::||:.:||.||||||:||::||:|||||||.||..:|||..|.||.|||.
 Frog   266 NSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTC 330

  Fly   325 ATNTENIKFVFTAVKDTILELHLSETNLL 353
            ||:||||:|||.|||||||:|:|.|.||:
 Frog   331 ATDTENIRFVFAAVKDTILQLNLKEYNLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 216/338 (64%)
G-alpha 34..347 CDD:206639 203/313 (65%)
gnaqNP_001037982.1 G-alpha 40..353 CDD:206639 203/313 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.