DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnaq

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001138271.1 Gene:gnaq / 570108 ZFINID:ZDB-GENE-081104-25 Length:359 Species:Danio rerio


Alignment Length:354 Identity:226/354 - (63%)
Similarity:285/354 - (80%) Gaps:2/354 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.||||::|.|.|||:.|||:.|:.:||.||||||||:||||||||:|||||||||||.|:.:::
Zfish     7 MACCLSEEAKEARRINDEIDRQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSEED 71

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKL-ADLVKSIDYKTVTRLEAPYLNAIKTL 129
            ||.|||.|:||||.:.||||.|||||:|.| :.||:|. |::|:.:|.:.|.....||::|||:|
Zfish    72 RKGFTKLVYQNIFTSSQSMIRAMDTLQILY-KYEHNKANANIVREVDVEKVFLFVNPYVDAIKSL 135

  Fly   130 WKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFL 194
            |.|.||:|||:|||||||:|||:|:||.:.||....|..|.||:|.||.|||.|:||||:|...:
Zfish   136 WNDPGIQECYDRRREYQLSDSTKYYLNSLDRIANPSYIPTQQDVLRVRVPTTGIIEYPFDLQSVI 200

  Fly   195 IRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQ 259
            .|:|||.|||:|||||||||.||||||||||:||:|..|.||:|:|||:||||||..||::.|||
Zfish   201 FRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQ 265

  Fly   260 HSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTV 324
            :|||||||||:||.::||:.:||.||||||:||::||:.||||||.||..:|||..|.||.|||.
Zfish   266 NSSVILFLNKKDLLEEKIMFSHLVDYFPEYDGPQRDAQTAREFILKMFVDLNPDSEKIIYSHFTC 330

  Fly   325 ATNTENIKFVFTAVKDTILELHLSETNLL 353
            ||:||||:|||.|||||||:|.|.|.||:
Zfish   331 ATDTENIRFVFAAVKDTILQLTLKEYNLV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 217/338 (64%)
G-alpha 34..347 CDD:206639 202/313 (65%)
gnaqNP_001138271.1 G_alpha 19..357 CDD:214595 217/338 (64%)
G-alpha 40..353 CDD:206639 202/313 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.