DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnaz

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_005155690.2 Gene:gnaz / 564915 ZFINID:ZDB-GENE-090420-3 Length:355 Species:Danio rerio


Alignment Length:363 Identity:146/363 - (40%)
Similarity:208/363 - (57%) Gaps:20/363 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKE 65
            |.|..|.:..|..|.||.||:.|::|.::.|||:|||:|||..|||:|.:|||:|||..||..:.
Zfish     1 MGCRQSTEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGGFNLEA 65

  Fly    66 RKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAP--------- 121
            .|::...:..|...::..:|.|:.||:|.:...:        ::.|...:..|..|         
Zfish    66 CKEYKPLILYNAIDSLTRIIRALATLKIDFHNPD--------RAYDAVQLFALTGPAESKGEITP 122

  Fly   122 -YLNAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVE 185
             .|..:|.||.|.|::||:.|..||.|.|:|.|:|||:.||...:|..|.:|||..|..||.|||
Zfish   123 ELLGVMKRLWADPGVQECFCRSNEYHLEDNTAYYLNDLDRISAPEYIPTVEDILRSRDMTTGIVE 187

  Fly   186 YPFNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFH 250
            ..|.......::|||.|||:||:||||||..||:|:|.|.:|.:||.|.|....:||.||..||.
Zfish   188 NKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQTSRMAESLRLFD 252

  Fly   251 NIISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPD-P 314
            :|.:.:||.::|:||||||:||..:||....|...|.:|.|.....:|| .::...|..:|.: .
Zfish   253 SICNNNWFTNTSLILFLNKKDLLAEKIKRIPLTVCFADYKGQNTYEEAA-VYVQRQFEDLNRNKE 316

  Fly   315 YKCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            .|.||.|||.||:|.||:|||.||.|.|::.:|....|
Zfish   317 TKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 141/348 (41%)
G-alpha 34..347 CDD:206639 130/323 (40%)
gnazXP_005155690.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.