DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gna15.4

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001038454.1 Gene:gna15.4 / 562625 ZFINID:ZDB-GENE-050208-781 Length:361 Species:Danio rerio


Alignment Length:344 Identity:139/344 - (40%)
Similarity:209/344 - (60%) Gaps:7/344 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERK 67
            ||||.........::|||.....::|:.|||:||||||:.||||:|.:||:::.||.|:.:.||:
Zfish    12 CCLSKNKRNAIAKNKEIDLDFIEQRKRERREIKLLVLGSAESGKSTLLKQIKMSHGNGYSEDERR 76

  Fly    68 QFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKD 132
            .|:|.|.||||:::::|..||..|||||...::..:..|:......:...:...::..|:.||.|
Zfish    77 GFSKLVHQNIFLSMKTMTDAMSELRIPYTNPQNQVIETLMLVSPLISTGHMCGIFVEPIRHLWAD 141

  Fly   133 AGIKECYN--RRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLI 195
            .|.|.|:.  ::....|| |.|||::.:.:|..::|..|.||||.|::.|..|.|....:..|..
Zfish   142 EGFKNCFKLCKKNHRHLT-SLEYFVDRLDQITANNYIPTIQDILRVQSSTNAIAELSIPMQIFTF 205

  Fly   196 RLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQH 260
            |.::|.|||.:||||||.|.|||:::|:.::||:| ...|..|.|||:||.:||:::.|..|...
Zfish   206 RFINVGGQRGQRRKWIHHFENVTTVIFVASLSEYD-EFLEENNKNRMEESLSLFNSVTSSPWLAQ 269

  Fly   261 SSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMF-TSVNPDPYKCIYPHFTV 324
            ||::|.|||:|...|||..:||..:|||:.|..:||..|.:|||..: .:|.||  :.||..|..
Zfish   270 SSILLLLNKKDFLAKKIQFSHLKTFFPEFTGKIQDADDAMKFILKSYERNVTPD--QLIYSQFIC 332

  Fly   325 ATNTENIKFVFTAVKDTIL 343
            ||:..:.|..|.|||||||
Zfish   333 ATDFIDTKIFFDAVKDTIL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 135/334 (40%)
G-alpha 34..347 CDD:206639 128/313 (41%)
gna15.4NP_001038454.1 G_alpha 22..355 CDD:214595 135/334 (40%)
G-alpha 43..355 CDD:206639 128/313 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.