DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnas

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_001335732.1 Gene:gnas / 557353 ZFINID:ZDB-GENE-090417-2 Length:419 Species:Danio rerio


Alignment Length:373 Identity:149/373 - (39%)
Similarity:215/373 - (57%) Gaps:43/373 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNVFQN 76
            |.:.||.|||.|||||::.::..:||:||.|||||:|.:|||||:|..||..:|:||..:::..|
Zfish    59 ENKRSRNIDKSLKAEKREYKQTHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKIQDIKNN 123

  Fly    77 IFMAIQSMISAMDTL-------------RIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKT 128
            |..||:::::||..|             ||.|       :.:|....|::..|.    :....||
Zfish   124 IKEAIETIVTAMSVLVPPVQLACPANKFRIDY-------ILNLANQKDFEFTTE----FYEHTKT 177

  Fly   129 LWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGF 193
            ||:|.|:|.|:.|..||||.|..:|||:.|..:::|||..||||:|..|..|:.|.|..|.:|..
Zfish   178 LWQDEGVKACFERSNEYQLIDCAQYFLDRIDTVKQSDYTPTDQDLLRCRVLTSGIFETRFQVDKV 242

  Fly   194 LIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWF 258
            ...:.||.|||.||||||.||::||:|:|:||.|.:::.|.|....||::|:..||.||.:..|.
Zfish   243 NFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVLREDNQTNRLQEALNLFKNIWNNRWL 307

  Fly   259 QHSSVILFLNKEDLFKKKILS--THLADYFPEY------------NGPKKDAKAAREFI----LY 305
            :..||||||||:||..:|:|:  :.:.|||||:            .|.......|:.||    |.
Zfish   308 RTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPDDATPEQGEDPRVTRAKYFIRDEFLR 372

  Fly   306 MFTSVNPDPYKCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNLL 353
            :.|:.....:.| |||||.|.:||||:.||...:|.|..:||.:..||
Zfish   373 ISTASGDGRHYC-YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 146/368 (40%)
G-alpha 34..347 CDD:206639 134/343 (39%)
gnasXP_001335732.1 G_alpha 61..416 CDD:214595 146/366 (40%)
G-alpha 81..413 CDD:206639 134/343 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.