DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gna14a

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_683989.2 Gene:gna14a / 556160 ZFINID:ZDB-GENE-081105-76 Length:354 Species:Danio rerio


Alignment Length:351 Identity:207/351 - (58%)
Similarity:266/351 - (75%) Gaps:0/351 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSDQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERK 67
            ||:|.:..|.:||::||||.|:.:||.:|||||||:||||||||:|||||||||||.|:.|.::|
Zfish     4 CCMSAEEKERQRINQEIDKQLRKDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDDDKK 68

  Fly    68 QFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAPYLNAIKTLWKD 132
            .|.|.|.||...|:|||:.|||.|:|.|...|:...:.||..|:...:..|:...:.|:.:||.|
Zfish    69 GFIKLVHQNTLSAMQSMVRAMDMLKIAYANSENQAHSALVNDIEVDKIMSLDETQVKALSSLWSD 133

  Fly   133 AGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRL 197
            :||:|||:||||||||||.:|:|:|:.||..:.|..|:||||.||.|||.|:||||:||..:.|:
Zfish   134 SGIQECYDRRREYQLTDSAKYYLSDLDRIANAAYVPTEQDILRVRVPTTGIIEYPFDLDNVIFRM 198

  Fly   198 VDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSS 262
            |||.|||:|||||||||.|||||:||||:||:|..|||.:|:|||:||||||..||::.|||.||
Zfish   199 VDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFQSSS 263

  Fly   263 VILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVATN 327
            |||||||.|:.|:||:.:|:|.||||:.|||.|.|||:||||.|:...|.|..|.||.|||.||:
Zfish   264 VILFLNKTDILKEKIVYSHVATYFPEFTGPKNDPKAAQEFILKMYQEENEDKDKTIYSHFTCATD 328

  Fly   328 TENIKFVFTAVKDTILELHLSETNLL 353
            ||||:.:|.|||||||..:|.|.||:
Zfish   329 TENIRLIFAAVKDTILRHNLKEFNLV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 201/337 (60%)
G-alpha 34..347 CDD:206639 187/312 (60%)
gna14aXP_683989.2 G_alpha 15..352 CDD:214595 201/336 (60%)
G-alpha 35..348 CDD:206639 187/312 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D373878at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.