DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gna12a

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001013295.1 Gene:gna12a / 503589 ZFINID:ZDB-GENE-050221-1 Length:385 Species:Danio rerio


Alignment Length:347 Identity:141/347 - (40%)
Similarity:210/347 - (60%) Gaps:6/347 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLDKERKQFTKNVFQ 75
            |.:|.|||||..||.|::..||.:|:|:||.|||||:||:|||||||||.|..|....|...:|:
Zfish    39 EAKRRSREIDSMLKRERRSIRRLVKILLLGAGESGKSTFLKQMRIIHGKEFDQKALLDFRDTIFE 103

  Fly    76 NIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLEAP-----YLNAIKTLWKDAGI 135
            |:...::.::.|.|.|.|.:...|:.|....|.|.:.|....:| |     |:.|::.||.|:||
Zfish   104 NVIKGMRVLVDARDKLGISWQNSENEKHGMFVMSFENKAGMAVE-PCTFQLYVPALQALWNDSGI 167

  Fly   136 KECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIVEYPFNLDGFLIRLVDV 200
            :|.|.||.|:||::|.:|||:::.||.:..|..:.||||..|..|..|||:.|.:.....::|||
Zfish   168 QEAYGRRSEFQLSESVKYFLDNLDRIGQLSYVPSRQDILLARKATKGIVEHDFVIKKIPFKMVDV 232

  Fly   201 AGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALFHNIISFSWFQHSSVIL 265
            .|||::|:||..||..:|||:|:|:.||:|..|.|....||:.||..:|..|::...|.:.|:||
Zfish   233 GGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFSNVSIIL 297

  Fly   266 FLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVNPDPYKCIYPHFTVATNTEN 330
            ||||.||..:|:....:..:|.::.|........:.:::..|.....:..|.::.|||.|.:|||
Zfish   298 FLNKMDLLVEKVRKVSICKHFSDFRGDPHRLVDVQAYLVQCFNRKRRNRIKPLFHHFTTAIDTEN 362

  Fly   331 IKFVFTAVKDTILELHLSETNL 352
            |:|||.|||||||:.:|.:..|
Zfish   363 IRFVFHAVKDTILQENLKDIML 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 139/342 (41%)
G-alpha 34..347 CDD:206639 127/317 (40%)
gna12aNP_001013295.1 G_alpha 41..383 CDD:214595 139/342 (41%)
G-alpha 62..379 CDD:206639 127/317 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.