DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17760 and gnai3

DIOPT Version :9

Sequence 1:NP_001036539.1 Gene:CG17760 / 36385 FlyBaseID:FBgn0033756 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001011471.1 Gene:gnai3 / 496962 XenbaseID:XB-GENE-5738634 Length:354 Species:Xenopus tropicalis


Alignment Length:364 Identity:161/364 - (44%)
Similarity:228/364 - (62%) Gaps:23/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDCCLS--DQACEERRISREIDKFLKAEKKKARRELKLLVLGTGESGKTTFIKQMRIIHGKGFLD 63
            |.|.||  |:|..||  |:.||:.|:.:.:||.:|:|||:||.|||||:|.:|||:|||..|:.:
 Frog     1 MGCTLSAEDKAAAER--SKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSE 63

  Fly    64 KERKQFTKNVFQNIFMAIQSMISAMDTLRIPYGQQEHSKLADLVKSIDYKTVTRLE--------A 120
            :|.:|:...|:.|...:|.::|.||..|||.:|        |:.::.|.:.:..|.        :
 Frog    64 EECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFG--------DVARADDARQLFVLASSAEEGVMS 120

  Fly   121 PYL-NAIKTLWKDAGIKECYNRRREYQLTDSTEYFLNDIARIERSDYQATDQDILHVRAPTTNIV 184
            |.| ..|:.||:|.|::.|::|.|||||.||..|:||||.||.:.:|..|.||:|..|..||.||
 Frog   121 PELAGVIQRLWEDPGVQACFSRSREYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIV 185

  Fly   185 EYPFNLDGFLIRLVDVAGQRTERRKWIHCFSNVTSIMFLVAMSEFDLSLAESENDNRMKESKALF 249
            |..|.......::.||.|||:||:||||||..||:|:|.||:|::||.|||.|..|||.||..||
 Frog   186 ETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLF 250

  Fly   250 HNIISFSWFQHSSVILFLNKEDLFKKKILSTHLADYFPEYNGPKKDAKAAREFILYMFTSVN-PD 313
            .:|.:..||..:|:||||||:|||::||..:.|...:|||:|.....:|| .:|...|..:| ..
 Frog   251 DSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAA-AYIQCQFEDLNRRK 314

  Fly   314 PYKCIYPHFTVATNTENIKFVFTAVKDTILELHLSETNL 352
            ..|.||.|||.||:|:|::|||.||.|.|::.:|.|..|
 Frog   315 DTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17760NP_001036539.1 G_alpha 13..351 CDD:214595 153/347 (44%)
G-alpha 34..347 CDD:206639 143/322 (44%)
gnai3NP_001011471.1 G-alpha 34..348 CDD:206639 143/322 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.